Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRS3 Peptide - middle region

BRS3 Peptide - middle region

Product Specifications

Product Name Alternative

BB3

UniProt

P32247

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001718.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldolase A/B/C Recombinant Chimeric Antibody Antibody
HA601511 100 µL

Aldolase A/B/C Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Human LOC102724770 activation kit by CRISPRa
GA119591 1 Kit

Human LOC102724770 activation kit by CRISPRa

Sign In for Pricing
View Details
Staurosporin
TRC-S685000-2.5MG 2.5 mg

Staurosporin

Sign In for Pricing
View Details
CDRT15 (NM_001007530) Human Over-expression Lysate
LC423498 20 µg

CDRT15 (NM_001007530) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse Epiregulin Protein (Sumo Tag)
PDEM100188-01 20 µg

Recombinant Mouse Epiregulin Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Mouse Epiregulin Protein (Sumo Tag)
PDEM100188-02 100 µg

Recombinant Mouse Epiregulin Protein (Sumo Tag)

Sign In for Pricing
View Details