Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BRS3 Peptide - middle region

BRS3 Peptide - middle region

Product Specifications

Product Name Alternative

BB3

UniProt

P32247

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001718.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLNIPTEEQSHARKQIESRKRIARTVLVLVALFALCWLPNHLLYLYHSFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(tert-Butylamino)-4-chloro-6-cyclopropylamino-1,3,5-triazine-d9
TRC-B690327-5MG 5 mg

2-(tert-Butylamino)-4-chloro-6-cyclopropylamino-1,3,5-triazine-d9

Sign In for Pricing
View Details
BFSP2 Polyclonal Antibody
E-AB-65999-01 60 µL

BFSP2 Polyclonal Antibody

Sign In for Pricing
View Details
BFSP2 Polyclonal Antibody
E-AB-65999-02 120 µL

BFSP2 Polyclonal Antibody

Sign In for Pricing
View Details
BFSP2 Polyclonal Antibody
E-AB-65999-03 200 µL

BFSP2 Polyclonal Antibody

Sign In for Pricing
View Details
Tyramide Amplification Kit with HRP Goat Anti-Mouse and CF®543 Tyramide
#33003 1 Kit

Tyramide Amplification Kit with HRP Goat Anti-Mouse and CF®543 Tyramide

Sign In for Pricing
View Details
Uroguanylin (GUCA2B) Rabbit Polyclonal Antibody
AP23440SU-S 20 µL

Uroguanylin (GUCA2B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details