Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNN3 Peptide - C-terminal region

CNN3 Peptide - C-terminal region

Product Specifications

UniProt

Q15417

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001272984.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD56 / NCAM (123A8, same as 56C04), CF405S conjugate, 0.1mg/mL
BNC040692-100 1x 100 µL

CD56 / NCAM (123A8, same as 56C04), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL6 Rabbit Polyclonal Antibody
TA384528 100 µL

IL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Isotype Control, Mouse IgG1 Kappa (IGG1/1331), APC-AstralTM813 Conjugate, 0.1 mg/mL
BNC131331-250 1x 250 µL

Isotype Control, Mouse IgG1 Kappa (IGG1/1331), APC-AstralTM813 Conjugate, 0.1 mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS622117 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
DNTTIP1 (NM_052951) Human Over-expression Lysate
LY403275 100 µg

DNTTIP1 (NM_052951) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant PDGFB Antibody
RC-5199-01 50 μL

Recombinant PDGFB Antibody

Sign In for Pricing
View Details