Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNN3 Peptide - C-terminal region

CNN3 Peptide - C-terminal region

Product Specifications

UniProt

Q15417

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001272984.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 3-Aminocrotonate
TRC-E898080-25G 25 g

Ethyl 3-Aminocrotonate

Sign In for Pricing
View Details
Human UGT (UGT1A9) activation kit by CRISPRa
GA110195 1 Kit

Human UGT (UGT1A9) activation kit by CRISPRa

Sign In for Pricing
View Details
(S)-3-Hydroxypyrrolidine
TRC-H953668-500MG 500 mg

(S)-3-Hydroxypyrrolidine

Sign In for Pricing
View Details
(11b)-21-(1-Ethoxyethoxy)-11,17-dihydroxy-pregn-4-ene-3,20-dione-d7
TRC-E892077-25MG 25 mg

(11b)-21-(1-Ethoxyethoxy)-11,17-dihydroxy-pregn-4-ene-3,20-dione-d7

Sign In for Pricing
View Details
UBE2M Antibody
KC-3445-01 50 μL

UBE2M Antibody

Sign In for Pricing
View Details
UBE2M Antibody
KC-3445-02 100 µL

UBE2M Antibody

Sign In for Pricing
View Details