Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WSB1 Peptide - middle region

WSB1 Peptide - middle region

Product Specifications

Product Name Alternative

SWIP1, WSB-1

UniProt

Q9Y6I7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_056441.6

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody
abx000500-01 20 µL

Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody

Sign In for Pricing
View Details
Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody
abx000500-02 100 µL

Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody

Sign In for Pricing
View Details
Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody
abx000500-03 2x 100 µL

Signal Transducer And Activator of Transcription 1 Phospho-Ser727 (STAT1 pS727) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal MAGI3 Antibody
NBP2-58916 100 µL

Rabbit Polyclonal MAGI3 Antibody

Sign In for Pricing
View Details
Nucleophosmin/NPM1 Rabbit Polyclonal Antibody (APC)
orb2622284 100 µg

Nucleophosmin/NPM1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
DNAJB13 siRNA (Mouse)
orb1841323-01 15 nmol

DNAJB13 siRNA (Mouse)

Sign In for Pricing
View Details