Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WSB1 Peptide - middle region

WSB1 Peptide - middle region

Product Specifications

Product Name Alternative

SWIP1, WSB-1

UniProt

Q9Y6I7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_056441.6

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human vWF (Von Willebrand Factor) ELISA Kit
MBS8821982-01 48 Well

Human vWF (Von Willebrand Factor) ELISA Kit

Sign In for Pricing
View Details
Human vWF (Von Willebrand Factor) ELISA Kit
MBS8821982-02 96 Well

Human vWF (Von Willebrand Factor) ELISA Kit

Sign In for Pricing
View Details
Human vWF (Von Willebrand Factor) ELISA Kit
MBS8821982-03 5x 96 Well

Human vWF (Von Willebrand Factor) ELISA Kit

Sign In for Pricing
View Details
Human vWF (Von Willebrand Factor) ELISA Kit
MBS8821982-04 10x 96 Well

Human vWF (Von Willebrand Factor) ELISA Kit

Sign In for Pricing
View Details
Cytochrome P450 26A1 Antibody
orb1424274 100 µL

Cytochrome P450 26A1 Antibody

Sign In for Pricing
View Details
Treprostinil diethanolamine
orb2900767-01 500 mg

Treprostinil diethanolamine

Sign In for Pricing
View Details