Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOT1 Peptide - middle region

ACOT1 Peptide - middle region

Product Specifications

Product Name Alternative

ACH2, CTE-1, LACH2

UniProt

Q86TX2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001032238.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPETGHYIEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cervical Cancer Fibroblast Cell Complete Medium
MBS2576874-01 100 mL

Human Cervical Cancer Fibroblast Cell Complete Medium

Sign In for Pricing
View Details
Human Cervical Cancer Fibroblast Cell Complete Medium
MBS2576874-02 4x 125 mL

Human Cervical Cancer Fibroblast Cell Complete Medium

Sign In for Pricing
View Details
Ppm1b (NM_033096) Rat Tagged Lenti ORF Clone
RR208616L4 10 µg

Ppm1b (NM_033096) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human P-Cadherin(Cadherin, Placental) ELISA Kit
SYP-H0241-01 48 Well

Human P-Cadherin(Cadherin, Placental) ELISA Kit

Sign In for Pricing
View Details
Human P-Cadherin(Cadherin, Placental) ELISA Kit
SYP-H0241-02 96 Well

Human P-Cadherin(Cadherin, Placental) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS553151 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details