Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOT1 Peptide - middle region

ACOT1 Peptide - middle region

Product Specifications

Product Name Alternative

ACH2, CTE-1, LACH2

UniProt

Q86TX2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001032238.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESTFLFLVGQDDHNWKSEFYANEACKRLQAHGRRKPQIICYPETGHYIEP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGALS9 ELISA Kit (Mouse)
OKCD02563-96W 96 Well

LGALS9 ELISA Kit (Mouse)

Sign In for Pricing
View Details
Influenza A H5N2 (A/American green-winged teal/California/HKWF609/2007) Hemagglutinin / HA Protein (His Tag)
E45O54557M2-100 100 µg

Influenza A H5N2 (A/American green-winged teal/California/HKWF609/2007) Hemagglutinin / HA Protein (His Tag)

Sign In for Pricing
View Details
LOC100188933 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7523504 1.0 µg DNA

LOC100188933 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Factor I antibody
20C-CR6099G 1 mL

Factor I antibody

Sign In for Pricing
View Details
TLS/FUS Rabbit Polyclonal Antibody (APC)
orb2614796 100 µg

TLS/FUS Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Mouse Ankrd34a activation kit by CRISPRa
GA217794 1 Kit

Mouse Ankrd34a activation kit by CRISPRa

Sign In for Pricing
View Details