IL9R Peptide - middle region
IL9R Peptide - middle region
Product Specifications
Product Name Alternative
CD129, IL-9R
UniProt
Q01113
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_002177.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAGCTEWRVQTLAYLPQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2658521-01 20 µg
Recombinant Human Charged multivesicular body protein 2b (CHMP2B)
Sign In for Pricing
View Details orb2658521-02 100 µg
Recombinant Human Charged multivesicular body protein 2b (CHMP2B)
Sign In for Pricing
View Details orb2658521-03 1 mg
Recombinant Human Charged multivesicular body protein 2b (CHMP2B)
Sign In for Pricing
View Details 036739-Biotin 200 µL
Hoxd9, ID (Hoxd9, Homeobox protein Hox-D9) (Biotin) discontinued
Sign In for Pricing
View Details