IL9R Peptide - middle region
IL9R Peptide - middle region
Product Specifications
Product Name Alternative
CD129, IL-9R
UniProt
Q01113
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_002177.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAGCTEWRVQTLAYLPQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1061168-01 0.02 mg (E-Coli)
Recombinant Vibrio cholerae serotype O1 Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
Sign In for Pricing
View Details MBS1061168-02 0.1 mg (E-Coli)
Recombinant Vibrio cholerae serotype O1 Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
Sign In for Pricing
View Details MBS1061168-03 0.02 mg (Baculovirus)
Recombinant Vibrio cholerae serotype O1 Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
Sign In for Pricing
View Details MBS1061168-04 0.02 mg (Mammalian-Cell)
Recombinant Vibrio cholerae serotype O1 Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
Sign In for Pricing
View Details