Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBNA1BP2 Peptide - middle region

EBNA1BP2 Peptide - middle region

Product Specifications

Product Name Alternative

P40, EBP2, NOBP

UniProt

Q99848

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153408.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQKPLAQRKKAGAKGQQMRKGPSAKRRYKNQKFGFGGKKKGSKWNTRESY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse WD repeat-containing protein 48 (WDR48) ELISA Kit
MBS281407-01 48 Tests

Mouse WD repeat-containing protein 48 (WDR48) ELISA Kit

Sign In for Pricing
View Details
Mouse WD repeat-containing protein 48 (WDR48) ELISA Kit
MBS281407-02 96 Tests

Mouse WD repeat-containing protein 48 (WDR48) ELISA Kit

Sign In for Pricing
View Details
Mouse WD repeat-containing protein 48 (WDR48) ELISA Kit
MBS281407-03 5x 96 Tests

Mouse WD repeat-containing protein 48 (WDR48) ELISA Kit

Sign In for Pricing
View Details
Mouse WD repeat-containing protein 48 (WDR48) ELISA Kit
MBS281407-04 10x 96 Tests

Mouse WD repeat-containing protein 48 (WDR48) ELISA Kit

Sign In for Pricing
View Details
CDC14B Rabbit Polyclonal Antibody (Cy7)
orb1039913 100 µL

CDC14B Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SCNN1G (Sodium channel epithelial 1 subunit gamma) for Antibody Discovery
MP1107X Each

Magic™ Membrane Protein Human SCNN1G (Sodium channel epithelial 1 subunit gamma) for Antibody Discovery

Sign In for Pricing
View Details