Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EBNA1BP2 Peptide - middle region

EBNA1BP2 Peptide - middle region

Product Specifications

Product Name Alternative

P40, EBP2, NOBP

UniProt

Q99848

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001153408.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQKPLAQRKKAGAKGQQMRKGPSAKRRYKNQKFGFGGKKKGSKWNTRESY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMC2 Antibody
orb1242632 100 µL

PSMC2 Antibody

Sign In for Pricing
View Details
CCL21, ID (CCL21, SCYA21, C-C motif chemokine 21, 6Ckine, Beta-chemokine exodus-2, Secondary lymphoid-tissue chemokine, Small-inducible cytokine A21) (Azide free) (HRP)
MBS6282040-01 0.2 mL

CCL21, ID (CCL21, SCYA21, C-C motif chemokine 21, 6Ckine, Beta-chemokine exodus-2, Secondary lymphoid-tissue chemokine, Small-inducible cytokine A21) (Azide free) (HRP)

Sign In for Pricing
View Details
CCL21, ID (CCL21, SCYA21, C-C motif chemokine 21, 6Ckine, Beta-chemokine exodus-2, Secondary lymphoid-tissue chemokine, Small-inducible cytokine A21) (Azide free) (HRP)
MBS6282040-02 5x 0.2 mL

CCL21, ID (CCL21, SCYA21, C-C motif chemokine 21, 6Ckine, Beta-chemokine exodus-2, Secondary lymphoid-tissue chemokine, Small-inducible cytokine A21) (Azide free) (HRP)

Sign In for Pricing
View Details
Bovine MCTS1 / Malignant T-cell-amplified sequence 1 Recombinant Protein
R15021b 1 Each

Bovine MCTS1 / Malignant T-cell-amplified sequence 1 Recombinant Protein

Sign In for Pricing
View Details
NCLN Antibody
MBS7134822-01 0.05 mL

NCLN Antibody

Sign In for Pricing
View Details
NCLN Antibody
MBS7134822-02 0.1 mL

NCLN Antibody

Sign In for Pricing
View Details