Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMPD3 Peptide - C-terminal region

AMPD3 Peptide - C-terminal region

Product Specifications

UniProt

Q01432

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000471.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cefmetazole Sodium
TRC-C242910-1G 1 g

Cefmetazole Sodium

Sign In for Pricing
View Details
PRLHR Polyclonal Antibody
E-AB-90181-01 60 µL

PRLHR Polyclonal Antibody

Sign In for Pricing
View Details
PRLHR Polyclonal Antibody
E-AB-90181-02 120 µL

PRLHR Polyclonal Antibody

Sign In for Pricing
View Details
PRLHR Polyclonal Antibody
E-AB-90181-03 200 µL

PRLHR Polyclonal Antibody

Sign In for Pricing
View Details
Abca1 Mouse Gene Knockout Kit (CRISPR)
KN500598 1 Kit

Abca1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ibuprofen Alcohol
TRC-I140045-1G 1 g

Ibuprofen Alcohol

Sign In for Pricing
View Details