Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AMPD3 Peptide - C-terminal region

AMPD3 Peptide - C-terminal region

Product Specifications

UniProt

Q01432

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000471.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: 1A11]
AM09004PU-N 100 µL

Clusterin (CLU) Mouse Monoclonal Antibody [Clone ID: 1A11]

Sign In for Pricing
View Details
Mouse Ak4 activation kit by CRISPRa
GA200142 1 Kit

Mouse Ak4 activation kit by CRISPRa

Sign In for Pricing
View Details
Human ASB10 activation kit by CRISPRa
GA115272 1 Kit

Human ASB10 activation kit by CRISPRa

Sign In for Pricing
View Details
Haptoglobin (HP) (NM_001126102) Human Over-expression Lysate
LC426644 20 µg

Haptoglobin (HP) (NM_001126102) Human Over-expression Lysate

Sign In for Pricing
View Details
Phosphocholine
TRC-P354508-250MG 250 mg

Phosphocholine

Sign In for Pricing
View Details
Idebenone Impurity 5
TRC-I170370-25MG 25 mg

Idebenone Impurity 5

Sign In for Pricing
View Details