Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL7 Peptide - middle region

ANGPTL7 Peptide - middle region

Product Specifications

Product Name Alternative

AngX, CDT6, dJ647M16.1

UniProt

O43827

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_066969.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-(+)-Menthofuran (>85%)
TRC-M218861-10MG 10 mg

(R)-(+)-Menthofuran (>85%)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), Biotin conjugate, 0.1mg/mL
BNCB1556-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IFITM2 Mouse Monoclonal Antibody [Clone ID: OTI3B1]
CF811625 100 µg

IFITM2 Mouse Monoclonal Antibody [Clone ID: OTI3B1]

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS507114 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
ATP2B4 Antibody
KC-3029-01 50 μL

ATP2B4 Antibody

Sign In for Pricing
View Details
ATP2B4 Antibody
KC-3029-02 100 µL

ATP2B4 Antibody

Sign In for Pricing
View Details