Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXTL2 Peptide - middle region

EXTL2 Peptide - middle region

Product Specifications

Product Name Alternative

EXTR2

UniProt

Q9UBQ6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028197.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 Reductase/POR Rabbit Polyclonal Antibody (PE)
orb2576161 100 µg

Cytochrome P450 Reductase/POR Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
MBNL1 Rabbit Polyclonal Antibody (Cy3)
orb2606370 100 µg

MBNL1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Tryptophan synthase alpha chain (trpA)
MBS1052525-01 0.02 mg (E-Coli)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Tryptophan synthase alpha chain (trpA)
MBS1052525-02 0.1 mg (E-Coli)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Tryptophan synthase alpha chain (trpA)
MBS1052525-03 0.02 mg (Yeast)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details
Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Tryptophan synthase alpha chain (trpA)
MBS1052525-04 0.1 mg (Yeast)

Recombinant Campylobacter jejuni subsp.jejuni serotype O:6 Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details