Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXTL2 Peptide - middle region

EXTL2 Peptide - middle region

Product Specifications

Product Name Alternative

EXTR2

UniProt

Q9UBQ6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001028197.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC24C (Center) Rabbit pAb
MBS8554344-01 0.1 mL

SEC24C (Center) Rabbit pAb

Sign In for Pricing
View Details
SEC24C (Center) Rabbit pAb
MBS8554344-02 0.1 mL (AF405L)

SEC24C (Center) Rabbit pAb

Sign In for Pricing
View Details
SEC24C (Center) Rabbit pAb
MBS8554344-03 0.1 mL (AF405S)

SEC24C (Center) Rabbit pAb

Sign In for Pricing
View Details
SEC24C (Center) Rabbit pAb
MBS8554344-04 0.1 mL (AF610)

SEC24C (Center) Rabbit pAb

Sign In for Pricing
View Details
SEC24C (Center) Rabbit pAb
MBS8554344-05 0.1 mL (AF635)

SEC24C (Center) Rabbit pAb

Sign In for Pricing
View Details
SEC24C (Center) Rabbit pAb
MBS8554344-06 0.1 mL (APC)

SEC24C (Center) Rabbit pAb

Sign In for Pricing
View Details