Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX6A1 Peptide - C-terminal region

COX6A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

COX6A, CMTRID, COX6AL

UniProt

P12074

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004364.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSCAR (NM_130771) Human Recombinant Protein
TP321675L 1 mg

OSCAR (NM_130771) Human Recombinant Protein

Sign In for Pricing
View Details
NucSpot® 500/515, 1000X in DMSO
#41040 1x 100 µL

NucSpot® 500/515, 1000X in DMSO

Sign In for Pricing
View Details
LINC00303 Human Gene Knockout Kit (CRISPR)
KN421004 1 Kit

LINC00303 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Genomic DNA, Prostate
CD564585 5 µg

Tissue Genomic DNA, Prostate

Sign In for Pricing
View Details
COG2 (NM_007357) Human Over-expression Lysate
LC402136 20 µg

COG2 (NM_007357) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS634816 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details