Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX6A1 Peptide - C-terminal region

COX6A1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

COX6A, CMTRID, COX6AL

UniProt

P12074

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004364.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Renal pelvis
CR560508 5 µg

Tissue Total RNA, Renal pelvis

Sign In for Pricing
View Details
Human ATP6AP1L activation kit by CRISPRa
GA114196 1 Kit

Human ATP6AP1L activation kit by CRISPRa

Sign In for Pricing
View Details
ABI2 (NM_005759) Human Over-expression Lysate
LY401755 100 µg

ABI2 (NM_005759) Human Over-expression Lysate

Sign In for Pricing
View Details
Nestin (Cancer Stem Cell Marker) (NES/2911), CF568 conjugate, 0.1mg/mL
BNC682911-500 1x 500 µL

Nestin (Cancer Stem Cell Marker) (NES/2911), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rnase2a Mouse Gene Knockout Kit (CRISPR)
KN514869 1 Kit

Rnase2a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glypican-3 (GPC3/863 + 1G12), CF555 conjugate, 0.1mg/mL
BNC550864-100 1x 100 µL

Glypican-3 (GPC3/863 + 1G12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details