What is the catalog number for STX4 Peptide - N-terminal region?

The catalog number for STX4 Peptide - N-terminal region is orb1998760.

What sizes are available for STX4 Peptide - N-terminal region?

STX4 Peptide - N-terminal region is available in the following size(s): 100 µg.

Is STX4 Peptide - N-terminal region in stock?

STX4 Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

STX4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

STX4A, p35-2

UniProt

Q12846

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001259025.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

sc-412772-ACT-2 20 µg

ANKRD50 CRISPR Activation Plasmid (h2)

Sign In for Pricing

View Details

NBP3-24041IR 0.1 mL

Rabbit Monoclonal RNA Polymerase II/POLR2A Antibody (POLR2A/9089R) [DyLight 755]

Sign In for Pricing

View Details

2060520/7A 1 Each

BEAKERS, POLYPROPYLENE, PRINTED GRADUATION

Sign In for Pricing

View Details

TU072817 1.0 mL

SDSL 3'UTR GFP Stable Cell Line

Sign In for Pricing

View Details

ABC-KH11741 1 Vial

Human PLEKHF2 knockout cell line

Sign In for Pricing

View Details

orb2911283-01 20 µg

Recombinant Arthrobacter aurescens ATP synthase subunit a (atpB)

Sign In for Pricing

View Details