What is the catalog number for CHMP5 Peptide - middle region?

The catalog number for CHMP5 Peptide - middle region is orb1998759.

What sizes are available for CHMP5 Peptide - middle region?

CHMP5 Peptide - middle region is available in the following size(s): 100 µg.

Is CHMP5 Peptide - middle region in stock?

CHMP5 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CHMP5 Peptide - middle region

Product Specifications

Product Name Alternative

Vps60, CGI-34, PNAS-2, C9orf83, HSPC177, SNF7DC2

UniProt

Q9NZZ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001182465.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NB100-56511CL1 0.1 mL

Mouse Monoclonal MyoD Antibody (5.8A) [CoraFluor 1]

Sign In for Pricing

View Details

RC216271A1V 250 µL

Human DUSP15 (NM_177991) AAV Particle

Sign In for Pricing

View Details

CF504000 100 µg

RGS16 Mouse Monoclonal Antibody [Clone ID: OTI3B4]

Sign In for Pricing

View Details

SC336856 10 µg

Hyaluronan synthase 1 (HAS1) (NM_001297436) Human Untagged Clone

Sign In for Pricing

View Details

DLR-CRIM1-Hu-96T 96 Tests

Human Cysteine Rich Transmembrane BMP Regulator 1 (CRIM1) ELISA Kit

Sign In for Pricing

View Details

MBS1098365 Inquire

Recombinant Lottia gigantea Peroxidase-like protein 1, partial

Sign In for Pricing

View Details