Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHMP5 Peptide - middle region

CHMP5 Peptide - middle region

Product Specifications

Product Name Alternative

Vps60, CGI-34, PNAS-2, C9orf83, HSPC177, SNF7DC2

UniProt

Q9NZZ3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001182465.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OTOGL sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2790206 1.0 µg DNA

OTOGL sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
4- (Butane-1-sulfonamido) benzoic acid
KJB69587-01 250 mg

4- (Butane-1-sulfonamido) benzoic acid

Sign In for Pricing
View Details
4- (Butane-1-sulfonamido) benzoic acid
KJB69587-02 2.5 g

4- (Butane-1-sulfonamido) benzoic acid

Sign In for Pricing
View Details
SCARA3 antibody
orb69921 100 µL

SCARA3 antibody

Sign In for Pricing
View Details
(1-Benzyl-2-methylpyrrolidin-2-yl) methanol
EEC96109-01 50 mg

(1-Benzyl-2-methylpyrrolidin-2-yl) methanol

Sign In for Pricing
View Details
(1-Benzyl-2-methylpyrrolidin-2-yl) methanol
EEC96109-02 0.5 g

(1-Benzyl-2-methylpyrrolidin-2-yl) methanol

Sign In for Pricing
View Details