LMBRD1 Peptide - C-terminal region
LMBRD1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
NESI, LMBD1, MAHCF, C6orf209
UniProt
Q9NUN5
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_060838.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YLFLHKFWFFSAAYYFGNWAFLGVFLIGLIVSCCKGKKSVIEGVDEDSDI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1413607-01 0.02 mg (E-Coli)
Recombinant Trichodesmium erythraeum NAD (P)H-quinone oxidoreductase subunit I (ndhI)
Sign In for Pricing
View Details MBS1413607-02 0.1 mg (E-Coli)
Recombinant Trichodesmium erythraeum NAD (P)H-quinone oxidoreductase subunit I (ndhI)
Sign In for Pricing
View Details MBS1413607-03 0.02 mg (Yeast)
Recombinant Trichodesmium erythraeum NAD (P)H-quinone oxidoreductase subunit I (ndhI)
Sign In for Pricing
View Details MBS1413607-04 0.1 mg (Yeast)
Recombinant Trichodesmium erythraeum NAD (P)H-quinone oxidoreductase subunit I (ndhI)
Sign In for Pricing
View Details