What is the catalog number for LMBRD1 Peptide - C-terminal region?

The catalog number for LMBRD1 Peptide - C-terminal region is orb1998758.

What sizes are available for LMBRD1 Peptide - C-terminal region?

LMBRD1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is LMBRD1 Peptide - C-terminal region in stock?

LMBRD1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

LMBRD1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NESI, LMBD1, MAHCF, C6orf209

UniProt

Q9NUN5

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060838.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLFLHKFWFFSAAYYFGNWAFLGVFLIGLIVSCCKGKKSVIEGVDEDSDI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MR218570L4 10 µg

Mob1b (NM_026735) Mouse Tagged Lenti ORF Clone

Sign In for Pricing

View Details

TL504745 1 Kit

Reep4 Mouse shRNA Plasmid (Locus ID 72549)

Sign In for Pricing

View Details

bs-13533R-BF750 100 µL

GPR35 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing

View Details

orb1833198-01 15 nmol

MMP11 siRNA (Rat)

Sign In for Pricing

View Details

orb1833198-02 30 nmol

MMP11 siRNA (Rat)

Sign In for Pricing

View Details

IC202RN-100UG 100 µg

Human IL-2 Alexa Fluor 700 MAb (Clone 5334R)

Sign In for Pricing

View Details