Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR7A3 Peptide - middle region

AKR7A3 Peptide - middle region

Product Specifications

Product Name Alternative

AFAR2

UniProt

O95154

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036199.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTWAEMYRNRYWKEHHFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B4GALT1 Blocking Peptide
MBS8243645-01 1 mg

B4GALT1 Blocking Peptide

Sign In for Pricing
View Details
B4GALT1 Blocking Peptide
MBS8243645-02 5 mg

B4GALT1 Blocking Peptide

Sign In for Pricing
View Details
B4GALT1 Blocking Peptide
MBS8243645-03 5x 5 mg

B4GALT1 Blocking Peptide

Sign In for Pricing
View Details
Rasa4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4521907 1.0 µg DNA

Rasa4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
LDB3 polyclonal antibody
orb641982-01 50 μL

LDB3 polyclonal antibody

Sign In for Pricing
View Details
LDB3 polyclonal antibody
orb641982-02 100 µL

LDB3 polyclonal antibody

Sign In for Pricing
View Details