Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR7A3 Peptide - middle region

AKR7A3 Peptide - middle region

Product Specifications

Product Name Alternative

AFAR2

UniProt

O95154

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_036199.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTWAEMYRNRYWKEHHFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ku-70 Polyclonal Antibody
orb1411436 100 µL

Ku-70 Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl 4- (trifluoromethylsulfonyloxy) cyclohex-3-ene-1-carboxylate
JH96795 1 Each

Ethyl 4- (trifluoromethylsulfonyloxy) cyclohex-3-ene-1-carboxylate

Sign In for Pricing
View Details
Human SPATA45 shRNA Plasmid
abx965626-01 150 µg

Human SPATA45 shRNA Plasmid

Sign In for Pricing
View Details
Human SPATA45 shRNA Plasmid
abx965626-02 300 µg

Human SPATA45 shRNA Plasmid

Sign In for Pricing
View Details
Rat Gremlin 1 (GREM1) ELISA Kit
EKU11707 96 Tests

Rat Gremlin 1 (GREM1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Plexin B3 CF
4958-PC-050 50 µg

Recombinant Human Plexin B3 CF

Sign In for Pricing
View Details