EEF1E1 Peptide - N-terminal region
EEF1E1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
P18, AIMP3
UniProt
O43324
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001129122.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQA
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6292311-01 0.2 mL
DLG7, ID (DLGAP5, DLG7, KIAA0008, Disks large-associated protein 5, Discs large homolog 7, Disks large-associated protein DLG7, Hepatoma up-regulated protein) (AP)
Sign In for Pricing
View Details 
MBS6292311-02 5x 0.2 mL
DLG7, ID (DLGAP5, DLG7, KIAA0008, Disks large-associated protein 5, Discs large homolog 7, Disks large-associated protein DLG7, Hepatoma up-regulated protein) (AP)
Sign In for Pricing
View Details ![Human Thyroid Cancer Cells (Undifferentiated) [KHM-5M]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
AFG-ELL-2007 > 1x 10^6 Cells / Vial
Human Thyroid Cancer Cells (Undifferentiated) [KHM-5M]
Sign In for Pricing
View Details 
MBS9944373 Inquire
Donkey E3 Ubiquitin-Protein Ligase ZFP91 (ZFP91) ELISA Kit
Sign In for Pricing
View Details orb1907697-01 5 mg
2-amino-9-[ (2R,3R,4R,5R) -3,4-dihydroxy-5- (hydroxymethyl) oxolan-2-yl]-7- (2,2,2-trifluoroethyl) -6,7,8,9-tetrahydro-1H-purine-6,8-dione
Sign In for Pricing
View Details