Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P3H2 Peptide - middle region

P3H2 Peptide - middle region

Product Specifications

Product Name Alternative

MCVD, MLAT4, LEPREL1

UniProt

Q8IVL5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001127890.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLNGTQRVLLDNVLSEEQCRELHSVASGIMLVGDGYRGKTSPHTPNEKFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human CD326/EPCAM Antibody (MT201), PerCP
MBS1583451-01 50 Tests

Anti-Human CD326/EPCAM Antibody (MT201), PerCP

Sign In for Pricing
View Details
Anti-Human CD326/EPCAM Antibody (MT201), PerCP
MBS1583451-02 100 Tests

Anti-Human CD326/EPCAM Antibody (MT201), PerCP

Sign In for Pricing
View Details
Anti-Human CD326/EPCAM Antibody (MT201), PerCP
MBS1583451-03 5x 100 Tests

Anti-Human CD326/EPCAM Antibody (MT201), PerCP

Sign In for Pricing
View Details
Myf-5 (h) -PR
sc-35988-PR 10 µM - 20 µL

Myf-5 (h) -PR

Sign In for Pricing
View Details
OAT Lentiviral Activation Particles (m2)
sc-421999-LAC-2 200 µL

OAT Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Monoclonal Antibody to Peroxisome Proliferator Activated Receptor Gamma (PPARg)
MBS2138788-01 0.1 mL

Monoclonal Antibody to Peroxisome Proliferator Activated Receptor Gamma (PPARg)

Sign In for Pricing
View Details