What is the catalog number for P3H2 Peptide - middle region?

The catalog number for P3H2 Peptide - middle region is orb1998755.

What sizes are available for P3H2 Peptide - middle region?

P3H2 Peptide - middle region is available in the following size(s): 100 µg.

Is P3H2 Peptide - middle region in stock?

P3H2 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

P3H2 Peptide - middle region

Product Specifications

Product Name Alternative

MCVD, MLAT4, LEPREL1

UniProt

Q8IVL5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001127890.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLNGTQRVLLDNVLSEEQCRELHSVASGIMLVGDGYRGKTSPHTPNEKFE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

orb2942122-01 50 mg

Chitosan (≥85% deacetylated, viscosity>90 mPa.s, MW 15000)

Sign In for Pricing

View Details

orb2942122-02 100 mg

Chitosan (≥85% deacetylated, viscosity>90 mPa.s, MW 15000)

Sign In for Pricing

View Details

orb2942122-03 250 mg

Chitosan (≥85% deacetylated, viscosity>90 mPa.s, MW 15000)

Sign In for Pricing

View Details

RP168062 100 µg

Rhox1 Recombinant Protein (Mouse)

Sign In for Pricing

View Details

MR215121L3 10 µg

Olfr652 (NM_147048) Mouse Tagged Lenti ORF Clone

Sign In for Pricing

View Details

CF804153 100 µg

FAF1 Mouse Monoclonal Antibody [Clone ID: OTI10G6]

Sign In for Pricing

View Details