Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF8 Peptide - middle region

RASSF8 Peptide - middle region

Product Specifications

Product Name Alternative

HOJ1, C12orf2

UniProt

Q8NHQ8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001158218.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Cortactin-binding protein 2
E13931m 96 Tests

ELISA Kit For Cortactin-binding protein 2

Sign In for Pricing
View Details
INSP3 antibody (Ser1598/1588)
70R-35490 100 ug

INSP3 antibody (Ser1598/1588)

Sign In for Pricing
View Details
Ccdc24 Rat shRNA Plasmid (Locus ID 500534)
TL708765 1 Kit

Ccdc24 Rat shRNA Plasmid (Locus ID 500534)

Sign In for Pricing
View Details
Afatinib Impurity 28
RM-A062028-01 10 mg

Afatinib Impurity 28

Sign In for Pricing
View Details
Afatinib Impurity 28
RM-A062028-02 25 mg

Afatinib Impurity 28

Sign In for Pricing
View Details
Afatinib Impurity 28
RM-A062028-03 50 mg

Afatinib Impurity 28

Sign In for Pricing
View Details