RASSF8 Peptide - middle region
RASSF8 Peptide - middle region
Product Specifications
Product Name Alternative
HOJ1, C12orf2
UniProt
Q8NHQ8
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001158218.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
12-9133B-100 100 µg
Biotinylated Anti-ITGA4 (natalizumab biosimilar) mAb
Sign In for Pricing
View Details 
MBS1222923-01 0.02 mg (E-Coli)
Recombinant Yersinia pestis bv. Antiqua UPF0758 protein YpAngola_A0055 (YpAngola_A0055)
Sign In for Pricing
View Details MBS1222923-02 0.1 mg (E-Coli)
Recombinant Yersinia pestis bv. Antiqua UPF0758 protein YpAngola_A0055 (YpAngola_A0055)
Sign In for Pricing
View Details