Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ENOSF1 Peptide - C-terminal region

ENOSF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RTS, TYMSAS

UniProt

Q7L5Y1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001119595.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKKLLPAQEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MANSC1 CytoSection
TS405173P5 25 Slides

MANSC1 CytoSection

Sign In for Pricing
View Details
2- (2,6-Dichlorophenyl) -2-hydroxyacetonitrile
FCA93121-01 100 mg

2- (2,6-Dichlorophenyl) -2-hydroxyacetonitrile

Sign In for Pricing
View Details
2- (2,6-Dichlorophenyl) -2-hydroxyacetonitrile
FCA93121-02 1 g

2- (2,6-Dichlorophenyl) -2-hydroxyacetonitrile

Sign In for Pricing
View Details
Human Desmoglein 1 (DSG1) ELISA Kit
EKU03708 96 Tests

Human Desmoglein 1 (DSG1) ELISA Kit

Sign In for Pricing
View Details
MRPL2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
30451151 3x 1.0 µg DNA

MRPL2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Echinocystic acid
MBS3608682-01 10 mg

Echinocystic acid

Sign In for Pricing
View Details