What is the catalog number for ENOSF1 Peptide - C-terminal region?

The catalog number for ENOSF1 Peptide - C-terminal region is orb1998750.

What sizes are available for ENOSF1 Peptide - C-terminal region?

ENOSF1 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is ENOSF1 Peptide - C-terminal region in stock?

ENOSF1 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

ENOSF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RTS, TYMSAS

UniProt

Q7L5Y1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001119595.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HFKYPVMIQRASYMPPKDPGYSTEMKEESVKKHQYPDGEVWKKLLPAQEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P520656 100 µg

AKT3 Protein (N-GST, Human)

Sign In for Pricing

View Details

GTR15098532 1 Vial

Lentiviral human PRKAA1 shRNA (UAS) - Lentiviral human PRKAA1 shRNA (UAS, RFP) (100)

Sign In for Pricing

View Details

T87894-01 10 mg

Aminooxy-PEG2-bis-PEG3-BCN

Sign In for Pricing

View Details

T87894-02 50 mg

Aminooxy-PEG2-bis-PEG3-BCN

Sign In for Pricing

View Details

19819031 100 µg

FAM164A Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing

View Details

GP6085-250mg 250 mg

Oxibendazole

Sign In for Pricing

View Details