Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST3GAL6 Peptide - middle region

ST3GAL6 Peptide - middle region

Product Specifications

Product Name Alternative

SIAT10, ST3GALVI

UniProt

Q9Y274

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258074.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARSK Rabbit Polyclonal Antibody
TA364618 100 µL

ARSK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BCL2 Mouse Monoclonal Antibody [Clone ID: OTI5H8]
CF806590 100 µg

BCL2 Mouse Monoclonal Antibody [Clone ID: OTI5H8]

Sign In for Pricing
View Details
ZFY (NM_001145276) Human Over-expression Lysate
LY428780 100 µg

ZFY (NM_001145276) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS710800 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
SPANXN4 (NM_001009613) Human Over-expression Lysate
LC422927 20 µg

SPANXN4 (NM_001009613) Human Over-expression Lysate

Sign In for Pricing
View Details
NDUFS3 Antibody
8C16845-AAT 50 µg

NDUFS3 Antibody

Sign In for Pricing
View Details