Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ST3GAL6 Peptide - middle region

ST3GAL6 Peptide - middle region

Product Specifications

Product Name Alternative

SIAT10, ST3GALVI

UniProt

Q9Y274

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001258074.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD81 / TAPA-1 (C81/2885R), CF568 conjugate, 0.1mg/mL
BNC682885-100 1x 100 µL

CD81 / TAPA-1 (C81/2885R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GATD3 (NM_198155) Human Over-expression Lysate
LC403674 20 µg

GATD3 (NM_198155) Human Over-expression Lysate

Sign In for Pricing
View Details
Monohydroxyisononyl Phthalate-d4
TRC-M547542-25MG 25 mg

Monohydroxyisononyl Phthalate-d4

Sign In for Pricing
View Details
Frozen Tissue Sections, Aortic valve
CS510409 5x 5 µm

Frozen Tissue Sections, Aortic valve

Sign In for Pricing
View Details
Human CENPJ activation kit by CRISPRa
GA111007 1 Kit

Human CENPJ activation kit by CRISPRa

Sign In for Pricing
View Details
ORC1 (7F6/1), CF640R conjugate, 0.1mg/mL
BNC403067-500 1x 500 µL

ORC1 (7F6/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details