PTPA Peptide - middle region
PTPA Peptide - middle region
Product Specifications
Product Name Alternative
PP2A, PR53, PPP2R4
UniProt
Q15257
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001180326.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1451808 1.0 µg DNA
NR1I2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
GTR15294454 1 Vial
Lentiviral mouse G0s2 shRNA (UAS) - Lentiviral mouse G0s2 shRNA (UAS) plasmid
Sign In for Pricing
View Details