Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDHAF1 Peptide - middle region

SDHAF1 Peptide - middle region

Product Specifications

Product Name Alternative

LYRM8

UniProt

A6NFY7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001036096.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEYLYRRGRRQLQLLRSGHATAMGAFVRPRAPTGEPGGVGCQPDDGDSPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diisodecyl Adipate
D32250-01 100 g

Diisodecyl Adipate

Sign In for Pricing
View Details
Diisodecyl Adipate
D32250-02 500 g

Diisodecyl Adipate

Sign In for Pricing
View Details
Anti-2B4/Cd244 Antibody Picoband®, PE Conjugate
A02527-1-PE 100 µg/Vial

Anti-2B4/Cd244 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
(E) -ethyl 4-oxo-4-phenylbut-2-enoate
RG-E200840-01 10 mg

(E) -ethyl 4-oxo-4-phenylbut-2-enoate

Sign In for Pricing
View Details
(E) -ethyl 4-oxo-4-phenylbut-2-enoate
RG-E200840-02 25 mg

(E) -ethyl 4-oxo-4-phenylbut-2-enoate

Sign In for Pricing
View Details
(E) -ethyl 4-oxo-4-phenylbut-2-enoate
RG-E200840-03 50 mg

(E) -ethyl 4-oxo-4-phenylbut-2-enoate

Sign In for Pricing
View Details