Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASSF4 Peptide - middle region

RASSF4 Peptide - middle region

Product Specifications

Product Name Alternative

AD037

UniProt

P50749

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_114412.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEEAPQLMRTKSDASCMSQRRPKCRAPGEAQRIRRHRFSINGHFYNHKTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS-L2 CRISPR/Cas9 KO Plasmid (h)
sc-411325 20 µg

ADAMTS-L2 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
C6orf184 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV814345 1.0 µg DNA

C6orf184 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Chicken P-CK ELISA Kit
ECKP0629 96 Tests

Chicken P-CK ELISA Kit

Sign In for Pricing
View Details
PDGF Receptor beta (PDGFRB) Rabbit Polyclonal Antibody
AP02728PU-N 100 µL

PDGF Receptor beta (PDGFRB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
G3BP-1, phosphorylated (Ser232) (GTPase-Activating Protein-Binding Protein 1, GAP SH3 Domain-Binding Protein 1, ATP-dependent DNA helicase VIII, HDH-VIII)
G0875-01 100 µg

G3BP-1, phosphorylated (Ser232) (GTPase-Activating Protein-Binding Protein 1, GAP SH3 Domain-Binding Protein 1, ATP-dependent DNA helicase VIII, HDH-VIII)

Sign In for Pricing
View Details
Alpha-Amylase (High Temperature)
CZM1092-01 100 U

Alpha-Amylase (High Temperature)

Sign In for Pricing
View Details