Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCC1 Peptide - C-terminal region

UQCC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BFZB, CBP3, UQCC, C20orf44

UniProt

Q9NVA1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171906.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSPTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF740 conjugate, 0.1mg/mL
BNC741884-500 1x 500 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Disposable Cuvette
S4100-1 1000 Units/Case

Disposable Cuvette

Sign In for Pricing
View Details
Frozen Tissue Sections, Parathyroid gland
CS629100 5x 5 µm

Frozen Tissue Sections, Parathyroid gland

Sign In for Pricing
View Details
Human ACSS1 activation kit by CRISPRa
GA113587 1 Kit

Human ACSS1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human MYDGF Protein (His Tag)
PKSH032635-01 10 µg

Recombinant Human MYDGF Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MYDGF Protein (His Tag)
PKSH032635-02 50 µg

Recombinant Human MYDGF Protein (His Tag)

Sign In for Pricing
View Details