Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCC1 Peptide - C-terminal region

UQCC1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BFZB, CBP3, UQCC, C20orf44

UniProt

Q9NVA1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171906.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSPTY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TyraMaxTM 490/520 Amplification Dye, 100X
#96137-20UL 1x 20 µL

TyraMaxTM 490/520 Amplification Dye, 100X

Sign In for Pricing
View Details
Human TMEM178B activation kit by CRISPRa
GA119321 1 Kit

Human TMEM178B activation kit by CRISPRa

Sign In for Pricing
View Details
(E,Z)-4-(4-Chloro-1,2-diphenylbut-I-en-I-yl)phenol (1:1)
TRC-O703020-50MG 50 mg

(E,Z)-4-(4-Chloro-1,2-diphenylbut-I-en-I-yl)phenol (1:1)

Sign In for Pricing
View Details
Kir5.1 (Ab-416) Antibody
8B1083-AAT 50 µg

Kir5.1 (Ab-416) Antibody

Sign In for Pricing
View Details
Bullet Ice Maker BIBU-101
BIBU-101 1 Unit

Bullet Ice Maker BIBU-101

Sign In for Pricing
View Details
RAB3IP Mouse Monoclonal Antibody [Clone ID: OTI5F2]
CF808960 100 µg

RAB3IP Mouse Monoclonal Antibody [Clone ID: OTI5F2]

Sign In for Pricing
View Details