What is the catalog number for FCGR2B Peptide - middle region?

The catalog number for FCGR2B Peptide - middle region is orb1998737.

What sizes are available for FCGR2B Peptide - middle region?

FCGR2B Peptide - middle region is available in the following size(s): 100 µg.

Is FCGR2B Peptide - middle region in stock?

FCGR2B Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

FCGR2B Peptide - middle region

Product Specifications

Product Name Alternative

CD32, FCG2, CD32B, FCGR2, IGFR2, FCGR2C, FcRII-c

UniProt

P31995

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_963857.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E51K62527 40 µL

PRKAR2A Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing

View Details

MBS6314857-01 0.2 mL

KRTAP1-3, ID (KRTAP1-3, B2B, KAP1.2, KAP1.3, KAP1.8, KAP1.9, KRATP1.9, KRTAP1.8, Keratin-associated protein 1-3, Keratin-associated protein 1.8, Keratin-associated protein 1.9) (FITC)

Sign In for Pricing

View Details

MBS6314857-02 5x 0.2 mL

KRTAP1-3, ID (KRTAP1-3, B2B, KAP1.2, KAP1.3, KAP1.8, KAP1.9, KRATP1.9, KRTAP1.8, Keratin-associated protein 1-3, Keratin-associated protein 1.8, Keratin-associated protein 1.9) (FITC)

Sign In for Pricing

View Details

GTR10423321 96 Well

Sheep Calcium activated potassium channel subunit β 3 (KCNMB3) ELISA kit

Sign In for Pricing

View Details

orb1244107 100 µL

TERF2 Antibody

Sign In for Pricing

View Details

38195016 1.0 µg DNA

Ptrhd1 ORF Vector (Rat) (pORF)

Sign In for Pricing

View Details