Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REPS2 Peptide - middle region

REPS2 Peptide - middle region

Product Specifications

Product Name Alternative

POB1

UniProt

Q8NFH8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001074444.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TKVQIPYLTTEKNSFKRMDDEDKQQETQSPTMSPLASPPSSPPHYQRVPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GLP1 Antibody (53) - BSA Free
NBP1-05184 100 µg

Mouse Monoclonal GLP1 Antibody (53) - BSA Free

Sign In for Pricing
View Details
Collagen 1 alpha 1/2 Blocking Peptide
CBP7519-01 1 mg

Collagen 1 alpha 1/2 Blocking Peptide

Sign In for Pricing
View Details
Collagen 1 alpha 1/2 Blocking Peptide
CBP7519-02 5 mg

Collagen 1 alpha 1/2 Blocking Peptide

Sign In for Pricing
View Details
Kylt® C. gallinacea
31643 100 Reactions

Kylt® C. gallinacea

Sign In for Pricing
View Details
GTF2E2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
22787066 1.0 µg DNA

GTF2E2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rat Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1) ELISA Kit
SL1980Ra-01 48 Tests

Rat Transient Receptor Potential Cation Channel Subfamily V, Member 1 (TRPV1) ELISA Kit

Sign In for Pricing
View Details