Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIPSNAP1 Peptide - C-terminal region

NIPSNAP1 Peptide - C-terminal region

Product Specifications

UniProt

Q9BPW8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001189431.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDIA3 Recombinant Rabbit Monoclonal Antibody [PSH08-79]
HA723031 100 µL

PDIA3 Recombinant Rabbit Monoclonal Antibody [PSH08-79]

Sign In for Pricing
View Details
DUSP6 (NM_001946) Human Over-expression Lysate
LY419629 100 µg

DUSP6 (NM_001946) Human Over-expression Lysate

Sign In for Pricing
View Details
CD5 (CD5/54/F6), CF568 conjugate, 0.1mg/mL
BNC680746-500 1x 500 µL

CD5 (CD5/54/F6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant PBK/TOPK Antibody
RC-4660-01 50 μL

Recombinant PBK/TOPK Antibody

Sign In for Pricing
View Details
Recombinant PBK/TOPK Antibody
RC-4660-02 100 µL

Recombinant PBK/TOPK Antibody

Sign In for Pricing
View Details
Recombinant PBK/TOPK Antibody
RC-4660-03 1 mL

Recombinant PBK/TOPK Antibody

Sign In for Pricing
View Details