Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIPSNAP1 Peptide - C-terminal region

NIPSNAP1 Peptide - C-terminal region

Product Specifications

UniProt

Q9BPW8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001189431.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD163 Human Knockdown Lysate
LY300094 100 µg

CD163 Human Knockdown Lysate

Sign In for Pricing
View Details
TDP43 Recombinant Rabbit monoclonal Antibody
HA750390 100 µL

TDP43 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR561192 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Rhog (NM_019566) Mouse Tagged ORF Clone
MG201818 10 µg

Rhog (NM_019566) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Aldo-keto Reductase Family 1 Member C2 / DD2 (CPTC-AKR1C2-1), CF405S conjugate, 0.1mg/mL
BNC042255-100 1x 100 µL

Aldo-keto Reductase Family 1 Member C2 / DD2 (CPTC-AKR1C2-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spata2 Mouse Gene Knockout Kit (CRISPR)
KN516545 1 Kit

Spata2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details