Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLC2 Peptide - middle region

KLC2 Peptide - middle region

Product Specifications

UniProt

Q9H0B6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001128246.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDNKPIWMHAEEREESKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf56 Protein Vector (Human) (pPB-His-MBP)
PV330114 500 ng

C1orf56 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details
RNY3P7 Protein Vector (Human) (pPM-C-HA)
PV119468 500 ng

RNY3P7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TRAF1 Antibody
RQ5773 100 µg

TRAF1 Antibody

Sign In for Pricing
View Details
MSS51 Recombinant Protein (Human)
RP076299 100 µg

MSS51 Recombinant Protein (Human)

Sign In for Pricing
View Details
LETM1 Polyclonal Antibody Bio Conjugated
orb1540782 100 µL

LETM1 Polyclonal Antibody Bio Conjugated

Sign In for Pricing
View Details
CCDC130 Protein Vector (Rat) (pPM-C-HA)
PV257876 500 ng

CCDC130 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details