Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLC2 Peptide - middle region

KLC2 Peptide - middle region

Product Specifications

UniProt

Q9H0B6

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001128246.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GDNKPIWMHAEEREESKDKRRDSAPYGEYGSWYKACKVDSPTVNTTLRSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thalidomide 5-Pip-C-oxotetrahydropyrimidin-bromophenyl
orb2665413-01 50 mg

Thalidomide 5-Pip-C-oxotetrahydropyrimidin-bromophenyl

Sign In for Pricing
View Details
Thalidomide 5-Pip-C-oxotetrahydropyrimidin-bromophenyl
orb2665413-02 10 mg

Thalidomide 5-Pip-C-oxotetrahydropyrimidin-bromophenyl

Sign In for Pricing
View Details
TSPAN19 Protein Vector (Human) (pPB-N-His)
PV140763 500 ng

TSPAN19 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse Peroxiredoxin-5, mitochondrial ELISA Kit
MBS765903-01 48 Well

Mouse Peroxiredoxin-5, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Peroxiredoxin-5, mitochondrial ELISA Kit
MBS765903-02 96 Well

Mouse Peroxiredoxin-5, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Mouse Peroxiredoxin-5, mitochondrial ELISA Kit
MBS765903-03 5x 96 Well

Mouse Peroxiredoxin-5, mitochondrial ELISA Kit

Sign In for Pricing
View Details