Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIPEP Peptide - middle region

MIPEP Peptide - middle region

Product Specifications

Product Name Alternative

MIP, HMIP

UniProt

Q99797

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005923.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKLNPQNSEVMPWDPPYYSGVIRAERYNIEPSLYCPFFSLGACMEGLNIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau antibody
20R-2278 0.05 mg

Tau antibody

Sign In for Pricing
View Details
Human Noggin protein
orb555711-01 10 µg

Human Noggin protein

Sign In for Pricing
View Details
Human Noggin protein
orb555711-02 50 µg

Human Noggin protein

Sign In for Pricing
View Details
Human Noggin protein
orb555711-03 500 µg

Human Noggin protein

Sign In for Pricing
View Details
Human Noggin protein
orb555711-04 1 mg

Human Noggin protein

Sign In for Pricing
View Details
Pseudomonas aeruginosa, serotype 9 (FITC)
P9175-01N-FITC 100 µL

Pseudomonas aeruginosa, serotype 9 (FITC)

Sign In for Pricing
View Details