MIPEP Peptide - C-terminal region
MIPEP Peptide - C-terminal region
Product Specifications
Product Name Alternative
MIP, HMIP
UniProt
Q99797
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_005923.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRFSHLVGYGARYYSYLMSRAVASMVWKECFLQDPFNRAAGERYRREMLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GWB-EB2F80 0.05 mg
Neurotensin Receptor Type 2 (NTR2) (NTSR2) Rabbit anti-Human Polyclonal (aa150-200) Antibody
Sign In for Pricing
View Details 031969-PE 200 µL
APG8b (MAP1LC3B), NT (T29) (MAP1LC3B, MAP1ALC3, Microtubule-associated proteins 1A/1B light chain 3B, Autophagy-related protein LC3 B, Autophagy-related ubiquitin-like modifier LC3 B, MAP1 light chain 3-like protein 2, MAP1A/MAP1B light chain 3 B, Microtubule-associated protein 1 light chain 3 beta) (PE) discontinued
Sign In for Pricing
View Details ![Ethyl 1H-pyrrolo[2,3-c]pyridine-3-carboxylate](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
244997-APC 100 µL
CSF2 (Colony Stimulating Factor 2 (Granulocyte-Macrophage), GMCSF, MGC131935, MGC138897) (APC)
Sign In for Pricing
View Details