What is the catalog number for MIPEP Peptide - C-terminal region?

The catalog number for MIPEP Peptide - C-terminal region is orb1998729.

What sizes are available for MIPEP Peptide - C-terminal region?

MIPEP Peptide - C-terminal region is available in the following size(s): 100 µg.

Is MIPEP Peptide - C-terminal region in stock?

MIPEP Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MIPEP Peptide - C-terminal region

Product Specifications

Product Name Alternative

MIP, HMIP

UniProt

Q99797

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005923.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRFSHLVGYGARYYSYLMSRAVASMVWKECFLQDPFNRAAGERYRREMLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TA811575S 30 µL

REV1 Mouse Monoclonal Antibody [Clone ID: OTI1E12]

Sign In for Pricing

View Details

E90735 100 µL

Csk Antibody

Sign In for Pricing

View Details

orb1665378-01 48 Tests

Equine Interleukin 8 (IL8) ELISA Kit

Sign In for Pricing

View Details

orb1665378-02 96 Tests

Equine Interleukin 8 (IL8) ELISA Kit

Sign In for Pricing

View Details

201-12-1648 96 Tests

Human breast cancer susceptibility protein 1 (BRCA-1) ELISA Kit

Sign In for Pricing

View Details

YP-W35999-01 48 Tests

Rat Ang-III (Ang-III) ELISA Kit

Sign In for Pricing

View Details