What is the catalog number for MIPEP Peptide - C-terminal region?

The catalog number for MIPEP Peptide - C-terminal region is orb1998729.

What sizes are available for MIPEP Peptide - C-terminal region?

MIPEP Peptide - C-terminal region is available in the following size(s): 100 µg.

Is MIPEP Peptide - C-terminal region in stock?

MIPEP Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MIPEP Peptide - C-terminal region

Product Specifications

Product Name Alternative

MIP, HMIP

UniProt

Q99797

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005923.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRFSHLVGYGARYYSYLMSRAVASMVWKECFLQDPFNRAAGERYRREMLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV151905 500 ng

ACR Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing

View Details

orb2088228 100 µL

MFSD4B Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing

View Details

SIPA187Ga01-01 10 µg

Recombinant Parathyroid Hormone Related Protein (PTHrP)

Sign In for Pricing

View Details

SIPA187Ga01-02 50 µg

Recombinant Parathyroid Hormone Related Protein (PTHrP)

Sign In for Pricing

View Details

SIPA187Ga01-03 200 µg

Recombinant Parathyroid Hormone Related Protein (PTHrP)

Sign In for Pricing

View Details

SIPA187Ga01-04 1 mg

Recombinant Parathyroid Hormone Related Protein (PTHrP)

Sign In for Pricing

View Details