Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOP3A Peptide - C-terminal region

TOP3A Peptide - C-terminal region

Product Specifications

Product Name Alternative

TOP3, ZGRF7

UniProt

Q13472

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004609.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CLCSQPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Thyroglobulin
E0355m 96 Tests

ELISA Kit For Thyroglobulin

Sign In for Pricing
View Details
Pgpep1 3'UTR Luciferase Stable Cell Line
TU216145 1.0 mL

Pgpep1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal CD58/LFA-3 Antibody (TS2/9) [FITC]
NBP2-22542F 0.2 mL

Mouse Monoclonal CD58/LFA-3 Antibody (TS2/9) [FITC]

Sign In for Pricing
View Details
ELISA Kit For Forkhead box protein O1
E0764b 96 Tests

ELISA Kit For Forkhead box protein O1

Sign In for Pricing
View Details
MAN2A1 Antibody
E38QA2423 100 µL

MAN2A1 Antibody

Sign In for Pricing
View Details
ADK, CT (Adenosine Kinase, AK, Adenosine 5'-phosphotransferase) (MaxLight 490)
MBS6461593-01 0.1 mL

ADK, CT (Adenosine Kinase, AK, Adenosine 5'-phosphotransferase) (MaxLight 490)

Sign In for Pricing
View Details